CAS 946870-92-4 Peptida Pertumbuhan Manusia IGF-1 DES 1mg Faktor Pertumbuhan Insulin-like LONG IGF-1

Informasi Dasar
Tempat asal: Cina
Nama merek: GSP
Sertifikasi: ISO9001,SGS,UKAS,GMP
Nomor model: IGF-1 DES
Kuantitas min Order: Gratis sampel tersedia
Harga: Negotiable
Kemasan rincian: 10iu vial, 10vials/kit
Waktu pengiriman: 3-6 hari kerja
Syarat-syarat pembayaran: Western Union, MoneyGram, T / T, Bitcoins
Menyediakan kemampuan: 10000-30000iu/bulan
Alias: IGF-1 Panjang R3 spesifikasi: 0.1mg, 1mg, 1g
Sinonim: Panjang R3-IGF-1 Sedang mengemas: Pengepakan rahasia untuk jaminan lulus Bea Cukai
Penampilan: bubuk lyophilized putih kasus: 946870-92-4
Surel: tonyraws810@gmail.com ada apa: 86-15871352379
Wikr: tonyraws
Cahaya Tinggi:

muscle building peptides

,

Hormon pertumbuhan peptida

IGF-I Des(1-3) Rekombinan Manusia yang diproduksi di E.Coli adalah rantai polipeptida tunggal, non-glikosilasi, yang mengandung 67 asam amino (aa 4-70) dan memiliki massa molekul 7368,5 Dalton.
IGF-1 Des1-3 dimurnikan dengan teknik kromatografi eksklusif.

 

Peptida Pertumbuhan Manusia IGF-1 DES 1mg Faktor Pertumbuhan Seperti Insulin PANJANG IGF-1

 

Faktor Pertumbuhan Seperti Insulin-1 DES (1-3):

 

Urutan

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLK

PAKSA

Sinonim

Somatomedin C, IGF-I, IGFI, IGF1, IGF-IA, Faktor pertumbuhan Mekano, MGF, Des(1-3), Des1-3,

Des 1-3, Des (1-3), IGF-1 (4-70).

Penampilan fisik Bubuk lyophilized (kering beku) putih yang disaring steril
Kelarutan

Direkomendasikan untuk menyusun kembali IGF-I des(1-3) dalam H2O 18M-cm steril tidak kurang dari

100µg/ml, yang kemudian dapat diencerkan lebih lanjut ke larutan berair lainnya.

Kemurnian Lebih besar dari 97,0% sebagaimana ditentukan oleh:
(a) Analisis dengan RP-HPLC.
(b) Analisis dengan SDS-PAGE.
Penggunaan

Produk ProSpec dilengkapi untuk PENGGUNAAN PENELITIAN LABORATORIUM SAJA.Produk

tidak boleh digunakan sebagai obat, produk pertanian atau pestisida, bahan tambahan makanan atau bahan kimia rumah tangga.

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Deskripsi:

 

DES IGF-1adalah versi yang lebih pendek dari rantai IGF-1.Ini lima (5) kali lebih kuat dari IGF-LR3 dan sepuluh (10) kali lebih kuat dari basis biasa IGF-1.Waktu paruh untuk DES adalah sekitar 20-30 menit, yang berarti ini adalah rantai yang sangat rumit.Oleh karena itu, pemberian hanya boleh dilakukan di tempat Anda ingin melihat pertumbuhan otot.DES memiliki kemampuan untuk merangsang hiperplasia otot lebih baik dari LR3.Dalam istilah sederhana, paling baik digunakan untuk injeksi situs, daripada pertumbuhan secara keseluruhan.

 

Selain itu, DES diketahui mengikat reseptor yang telah diubah bentuknya oleh asam laktat, yang sering ada selama latihan.Hal ini memungkinkan DES untuk menempelkan dirinya ke reseptor yang bermutasi dan memberi sinyal pertumbuhan jaringan selama pelatihan.DES dapat digunakan lebih lama dan lebih sering daripada LR3.

 

IGF1 DES:

 

Insulin Like Growth Factor (IGF)-1 (4-70), atau dikenal sebagai IGF-1 DES, diproduksi di E. coli, adalah rantai polipeptida tunggal, non-glikosilasi, yang mengandung 67 asam amino dan memiliki massa molekul 7.372 da.Studi in vitro menunjukkan bahwa pada dosis yang sama DES (1-3) IGF sepuluh kali lebih kuat daripada IGF-1 dalam merangsang hipertrofi dan proliferasi dalam sel yang dikultur.Ini kemungkinan dihasilkan melalui modifikasi pasca-translasi dalam urutan IGF-1 matang yang bersirkulasi melalui aksi protease.

 

IGF-1 DES adalah bentuk terbelah dari IGF-1 dan mengandung asam amino 4-70.Struktur ini memungkinkan efek protein IGF-1 untuk diperkuat dalam bentuk yang lebih stabil dari fragmen protein peptida molekul DES 1,3 dari faktor pertumbuhan seperti insulin 1. IGF-1 DES, atau faktor pertumbuhan seperti insulin DES, berasal dari keluarga peptida IGF-1 yang berperan penting dalam pertumbuhan dan perkembangan mamalia.IGF1 memediasi banyak efek pemacu pertumbuhan hormon pertumbuhan dan IGF-1 DES, meskipun lebih pendek, menyebabkan perubahan fisik protein yang mengubah fisiologis dalam jumlah yang sama.Studi awal menunjukkan bahwa hormon pertumbuhan tidak secara langsung merangsang penggabungan sulfat ke dalam tulang rawan, melainkan bertindak melalui faktor serum, yang disebut 'faktor sulfasi', yang kemudian dikenal sebagai 'somatomedin' atau IGF-1 dan baru-baru ini melalui pemotongan, DES IGF-1.

 

CAS 946870-92-4 Peptida Pertumbuhan Manusia IGF-1 DES 1mg Faktor Pertumbuhan Insulin-like LONG IGF-1 0

 

Dosis:

 

DES IGF-1 dapat diberi dosis 50-150mcg beberapa kali sehari (sebelum pelatihan) ke area target tertentu.karena DES memiliki waktu paruh yang singkat (20-30 menit), desensitisasi tidak diperhatikan sama sekali .Situs injeksi harus dilokalisasi;sebaiknya, pada kelompok otot yang ingin Anda kembangkan.Secara sederhana, jika Anda ingin menumbuhkan bisep Anda, suntikkan IGF-1 DES langsung ke bisep Anda.

 

IGF-1 vs. HGH:

 

Mengapa IGF-1 dan bukan GH?Hormon pertumbuhan sebenarnya adalah prekursor IGF-1.Hormon pertumbuhan tidak secara langsung menyebabkan pertumbuhan otot, tetapi secara tidak langsung menyebabkan pertumbuhan otot dengan memberi sinyal pelepasan IGF-1.Hormon Pertumbuhan Manusia (HGH) bisa sangat mahal, dan untuk melihat pertumbuhan otot perlu dipasangkan dengan insulin atau steroid anabolik lainnya.Hal ini membuat varian IGF-1 seperti LR3 dan DES, yang dapat digunakan sebagai obat mandiri, menjadi pilihan yang jauh lebih layak bagi binaragawan yang ingin melihat pemulihan jaringan yang rusak dan pertumbuhan otot yang solid.

 

Kelas Reseptor vs Kelas Media IGF-1 LR3:


Asli Receptor Grade LR3 IGF-I adalah reagen penelitian berkualitas tinggi untuk digunakan dalam studi tentang pertumbuhan sel, reseptor IGF dan protein pengikat IGF dan lebih kuat daripada rH IGF-1 dan Media Grade IGF-1 LR3 baik in vivo maupun in vitro karena untuk peningkatan drastis dalam aktivitas biologis (afinitas yang lebih kuat untuk mengikat dengan reseptor IGF) dan kemurnian tingkat tinggi.Kombinasi peningkatan aktivitas biologis dan kemurnian inilah yang membedakan Receptor Grade IGF-1 LR3 dari IGF-1 standar.Media grade LR3 IGF-I lebih umum digunakan dalam kultur sel komersial vs mamalia.Ini juga dapat digunakan sebagai reagen penelitian dengan biaya ekonomis untuk memungkinkan studi di mana potensi biologis bernilai lebih rendah dan jumlah yang lebih tinggi diperlukan.Untuk memaksimalkan hasil dalam studi atau produksi sel berbasis hewani, Reseptor Grade IGF-1 Long R3 harus digunakan secara eksklusif.

 

Apakah Anda memiliki kebijakan pengiriman ulang?

 

Kami memiliki layanan purna jual yang baik dan kebijakan pengiriman ulang jika paket hilang.
Hubungan panjang kami dengan klien kami telah membawa manfaat besar.
Kami selalu sangat berhati-hati dalam mengemas produk kami.
Klien kami akan mengonfirmasi hal ini karena terkadang mereka kesulitan menemukannya tanpa bantuan.
Namun terlepas dari upaya terbaik kami, masih mungkin untuk merebut sejumlah kecil paket.
Dalam keadaan ini kami berjanji reship gratis untuk membangun hubungan jangka panjang.

 

Pengiriman:

 

1. Lebih disukai DHL atau HKEMS untuk jumlah kurang dari 50 KG;
2. Pengiriman laut untuk jumlah lebih dari 60 KG.100% aman!
3. Kirim dari agen kami di Belanda, Singapura, Laos, AS

 

Setiap kebutuhan, silahkan hubungi saya

Email: tonyraws810@gmail.com

Whatsapp: 86-15871352379

Wickr: tonyraws

Rincian kontak
Sales Manager

Nomor telepon : +8613657291547

Ada apa : +https://api.whatsapp.com/send?phone=8615871352379